PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco005138.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family YABBY
Protein Properties Length: 179aa    MW: 19962.6 Da    PI: 9.4869
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco005138.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY177.67.7e-552115223170
        YABBY  23 avsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPe 120
                  avsvP++ ++++vtvrCGhC++llsvn+  + q l+ ++         ++++ +++++   ++ +++++++t + +++++++++  vp     irPPe
  Aco005138.1  21 AVSVPNNNILNIVTVRCGHCANLLSVNMGAFLQSLPLQDA--------QVHNIGFHDKC--EYGSSSKCNRT-TVMYSMQSEQQPTVP-----IRPPE 102
                  8***********************************9996........66677777653..23333333333.334455666666666.....8**** PP

        YABBY 121 krqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                  krqrvPsaynrfikeeiqrika+nPdishreafsaaaknWahfP+ihfgl
  Aco005138.1 103 KRQRVPSAYNRFIKEEIQRIKANNPDISHREAFSAAAKNWAHFPHIHFGL 152
                  ************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.6E-5921152IPR006780YABBY protein
SuperFamilySSF470953.01E-986145IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.8E-5100146IPR009071High mobility group box domain
CDDcd013907.00E-6106142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MSSHHLPQHE SYIGRSDPSS AVSVPNNNIL NIVTVRCGHC ANLLSVNMGA FLQSLPLQDA  60
QVHNIGFHDK CEYGSSSKCN RTTVMYSMQS EQQPTVPIRP PEKRQRVPSA YNRFIKEEIQ  120
RIKANNPDIS HREAFSAAAK NWAHFPHIHF GLTLDSKKQV KLDDTIATPA PQKAKGFY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6662625e-59KM666262.1 Ananas bracteatus clone 51551b microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008778120.11e-85PREDICTED: protein YABBY 2-like isoform X1
SwissprotQ10FZ71e-64YAB2_ORYSJ; Protein YABBY 2
TrEMBLM0TFM37e-85M0TFM3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P07830_0012e-84(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139437121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.27e-57YABBY family protein